PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g10330.1.p
Common NameBRADI_1g10330, LOC100831491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 542aa    MW: 58401.2 Da    PI: 4.8067
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g10330.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.31.2e-1061725413374
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       + Ll+c +a ++ +  la + La+++  a+ +gdp +R+a+yf  ALa+rla    + ++ +++  +++   +e +  +k++++++P+ kf+h
  Bradi1g10330.1.p 172 QSLLACSRAAAA-NSGLAATELAKVRAVATDSGDPAERVAFYFSDALARRLAC--GGAASPVTAA-DARFAADELTLCYKTLNDACPYSKFAH 260
                       7899***98877.677888889******************************8..4444433333.33456999999**************** PP

              GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ltaNqaIlea+  ++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++Ri gv sp  g   + +l +t  rL++fA+ lgv+fef + + + 
  Bradi1g10330.1.p 261 LTANQAILEATGAATKIHIVDFGIVQGIQWAALLQALATRPEGKPsRIRISGVPSPFLGpePAASLAATSARLRDFAKLLGVDFEFVP-LLRP 352
                       *****************************************887769********98888899*************************.599* PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       +++l+ +++ ++p+E++aVn++lql++ll   ++++++ ++vL+l ksl P vv++ e e+++n++ F++rf++al+yy  +f+sl++ ++r+
  Bradi1g10330.1.p 353 VDELDQSDFLIEPDEVVAVNFMLQLYHLL---GDSDEPVRRVLRLAKSLHPAVVTLGEYEVSLNRAGFVDRFANALSYYRLVFESLDVAMARD 442
                       *****************************...66666777***************************************************** PP

              GRAS 279 seerikvErellgreivnvvac.egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLv 368
                       s+er+++Er ++g++i+ +v   ega+r+ r+   ++W+  +e +GF+pv+ls++a++qa+lll +++ +  y++ e + +++ l W++rpL+
  Bradi1g10330.1.p 443 SQERVMMERCMFGERIRRAVGPgEGADRTDRMAGSSEWQTLMEWCGFEPVRLSNYAMSQADLLLWNYDsKYKYSLVELQPAFLsLAWEKRPLL 535
                       ********************8549999*****************************************77789999****9999********* PP

              GRAS 369 svSaWr 374
                       +vSaWr
  Bradi1g10330.1.p 536 TVSAWR 541
                       *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819951.62E-61158No hitNo description
SuperFamilySSF819951.62E-696159No hitNo description
PROSITE profilePS5098555.992144519IPR005202Transcription factor GRAS
PfamPF035144.1E-104172541IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIQ QQQQQQQHHQ QRHHHHLAPP MPSAPAPPHA QIPASLPYGG  60
ASAGWPQAEH FFSDVFGASA ADAVFSDLAT AADFDSDGWM ESLIGDAPVF QDSDLDRLIF  120
TTPPPPVPPP AEPAAAQAEN APASLPLAAA TTPVACSPAS SSDTSCSAPI LQSLLACSRA  180
AAANSGLAAT ELAKVRAVAT DSGDPAERVA FYFSDALARR LACGGAASPV TAADARFAAD  240
ELTLCYKTLN DACPYSKFAH LTANQAILEA TGAATKIHIV DFGIVQGIQW AALLQALATR  300
PEGKPSRIRI SGVPSPFLGP EPAASLAATS ARLRDFAKLL GVDFEFVPLL RPVDELDQSD  360
FLIEPDEVVA VNFMLQLYHL LGDSDEPVRR VLRLAKSLHP AVVTLGEYEV SLNRAGFVDR  420
FANALSYYRL VFESLDVAMA RDSQERVMME RCMFGERIRR AVGPGEGADR TDRMAGSSEW  480
QTLMEWCGFE PVRLSNYAMS QADLLLWNYD SKYKYSLVEL QPAFLSLAWE KRPLLTVSAW  540
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.01675411375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560467.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL031e-149SCL4_ARATH; Scarecrow-like protein 4
TrEMBLI1GNV60.0I1GNV6_BRADI; Uncharacterized protein
STRINGBRADI1G10330.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Representative plantOGRP67991519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-129GRAS family protein